PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G11830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 552aa    MW: 60565.8 Da    PI: 6.7523
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G11830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.64.5e-1181118745
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       Ede l++ ++ +G ++W+t+ar ++ gR + qc+ rw 
  ORUFI02G11830.1  81 HEDESLIQMINIYGHNNWETVARAIP-GRNAQQCRVRWK 118
                      69************************.***********6 PP

2Myb_DNA-binding33.97.2e-11127169145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W+ eE+++l+++ + +G++ W + a+++  gRt   +k++w+
  ORUFI02G11830.1 127 KQAWSREEELRLIHVQQIYGNK-WCRMAEHFT-GRTSAAIKEHWR 169
                      799*******************.********9.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-1681129IPR009057Homeodomain-like
SMARTSM007171.7E-581123IPR001005SANT/Myb domain
SuperFamilySSF466895.14E-2181168IPR009057Homeodomain-like
PfamPF139216.7E-1282138No hitNo description
CDDcd001672.68E-1082121No hitNo description
PROSITE profilePS500908.94382121IPR017877Myb-like domain
PROSITE profilePS5129418.812122176IPR017930Myb domain
SMARTSM007171.3E-9126174IPR001005SANT/Myb domain
CDDcd001677.91E-9129169No hitNo description
Gene3DG3DSA:1.10.10.604.3E-15130177IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MASRAVEGEG EEEGEGKGNL GNALEDSHKH CQGEELEAGQ SCKINYQDVI DKCGIEISEK  60
RRRRWSTKES CLDFYFIILL HEDESLIQMI NIYGHNNWET VARAIPGRNA QQCRVRWKFN  120
LDPAISKQAW SREEELRLIH VQQIYGNKWC RMAEHFTGRT SAAIKEHWRG PMKRKLNSYL  180
ASGLLKKSPG LPENLSVPQS SDSNILQQCD VSSYENKLLS DLRPSLKSKE GVCSKCDGSS  240
SDNQLLSDLR ASLKSKGASS KCDGSSGDNQ LLSDLRASLK SKGASSKCDG SSGDNQLLSD  300
LRASLKSKEG ASSKCDGSSD ENKLLSDLRA CLKSKQGASS KCDGSSGENQ LLSDLQASLM  360
SKQRTSSKYK QGASSKSKQG TSSKSKQGFI DLCENTDTSE GESSELICTE RPDPDSGEAS  420
KRIRDRLNWR KRARKKLVFL SSPVELKVSA VAESERHLQE SKVTSPEVNI VSPPAVLQGF  480
SPEVPSVCEK IVEPPLADFN QSKNVCSSLE TSSDPCTLEQ HLANVSDLLD MSYIDGLMII  540
PPAGCPYDGD FI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-208217814110B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1420436KRIRDRLNWRKRARKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1209130.0AK120913.1 Oryza sativa Japonica Group cDNA clone:J023034G08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622738.10.0PREDICTED: myb-like protein Q
TrEMBLA0A0E0NCV30.0A0A0E0NCV3_ORYRU; Uncharacterized protein
STRINGBGIOSGA007946-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP165241011
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.12e-33myb domain protein 3r-4